PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca58040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NF-YB
Protein Properties Length: 176aa    MW: 19084.2 Da    PI: 6.5329
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca58040.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB178.37.1e-5629123195
       NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                 vreqd++lPianvsrimkk+lPan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plkvyl+++re ++
  Dca58040.1  29 VREQDKYLPIANVSRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKVYLTRFREGDT 123
                 69*****************************************************************************************9665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.9E-5325146IPR009072Histone-fold
SuperFamilySSF471131.71E-3832142IPR009072Histone-fold
PfamPF008084.1E-283699IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.8E-206381No hitNo description
PROSITE patternPS0068506682IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.8E-2082100No hitNo description
PRINTSPR006152.8E-20101119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MAEQGSPGGG GGGGSHDSGG DQSPRSSSVR EQDKYLPIAN VSRIMKKALP ANGKIAKDAK  60
ETVQECVSEF ISFITSEASD KCQREKRKTI NGDDLLWAMA TLGFEDYIDP LKVYLTRFRE  120
GDTKGSTKGG ETLGRRDSMG QSVSNAQLTH QGSFNQQMNY GDAQVQQVMI PMNGRE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A8e-5028120193NF-YB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010667231.15e-96PREDICTED: nuclear transcription factor Y subunit B-10
SwissprotQ8VYK41e-82NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLA0A0H3XVT98e-93A0A0H3XVT9_VERFO; Nuclear transcription factor Y subunit B-5
STRINGGLYMA03G33490.15e-88(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53340.12e-76nuclear factor Y, subunit B10